Host taxon 9606
Protein NP_001123357.1
putative cleavage and polyadenylation specificity factor subunit 4-like protein
Homo sapiens
Gene CPSF4L, UniProt A6NMK7
>NP_001123357.1|Haemophilus ducreyi 35000HP|putative cleavage and polyadenylation specificity factor subunit 4-like protein
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHDRGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECSFLHVKPAFKSQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.93 | -0.93275862964593 | 0.046 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)