Host taxon 9606
Protein NP_001258759.1
Purkinje cell protein 2 homolog isoform 2
Homo sapiens
Gene PCP2, UniProt Q8IVA1
>NP_001258759.1|Haemophilus ducreyi 35000HP|Purkinje cell protein 2 homolog isoform 2
MAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDMLASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.5 | -0.500432674789964 | 0.021 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)