Host taxon 9606
Protein NP_001165828.1
pulmonary surfactant-associated protein C isoform 2
Homo sapiens
Gene SFTPC, UniProt P11686
>NP_001165828.1|Haemophilus ducreyi 35000HP|pulmonary surfactant-associated protein C isoform 2
MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCGEVPLYYI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.92 | -1.91949720044877 | 0.024 | 31213562 | |
Retrieved 1 of 4 entries in 0.8 ms
(Link to these results)