Host taxon 9606
Protein NP_001138996.1
protein yippee-like 3 isoform 2
Homo sapiens
Gene YPEL3, UniProt P61236
>NP_001138996.1|Haemophilus ducreyi 35000HP|protein yippee-like 3 isoform 2
MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.63 | 0.631427743693694 | 0.016 | 31213562 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)