Host taxon 9606
Protein NP_001182029.1
protein tyrosine phosphatase type IVA 2 isoform 3
Homo sapiens
Gene PTP4A2, UniProt Q12974
>NP_001182029.1|Haemophilus ducreyi 35000HP|protein tyrosine phosphatase type IVA 2 isoform 3
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.83 | 0.8259660684106 | 4.8e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)