Host taxon 9606
Protein NP_001012474.1
protein transport protein Sec61 subunit gamma
Homo sapiens
Gene SEC61G, UniProt P60059
>NP_001012474.1|Haemophilus ducreyi 35000HP|protein transport protein Sec61 subunit gamma
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.61 | 1.61296831321566 | 2.5e-8 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)