Host taxon 9606
Protein NP_006799.1
protein transport protein Sec61 subunit beta
Homo sapiens
Gene SEC61B, UniProt P60468
>NP_006799.1|Haemophilus ducreyi 35000HP|protein transport protein Sec61 subunit beta
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.7 | 1.69629303891022 | 6.4e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)