Host taxon 9606
Protein NP_001003665.1
protein stum homolog
Homo sapiens
Gene STUM, UniProt Q69YW2
>NP_001003665.1|Haemophilus ducreyi 35000HP|protein stum homolog
MEPSHKDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFLNTFVPGLGTFVSAFTVLCGARTDLPDRHVCCVFWLNIAAALIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.66 | -1.65576819902839 | 5.1e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)