Host taxon 9606
Protein NP_001036158.1
protein shisa-like-2A
Homo sapiens
Gene SHISAL2A, UniProt Q6UWV7
>NP_001036158.1|Haemophilus ducreyi 35000HP|protein shisa-like-2A
MSGACTSYVSAEQEVVRGFSCPRPGGEAAAVFCCGFRDHKYCCDDPHSFFPYEHSYMWWLSIGALIGLSVAAVVLLAFIVTACVLCYLFISSKPHTKLDLGLSLQTAGPEEVSPDCQGVNTGMAAEVPKVSPLQQSYSCLNPQLESNEGQAVNSKRLLHHCFMATVTTSDIPGSPEEASVPNPDLCGPVP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ 3.07 | 3.06967502796308 | 9.7e-11 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)