Host taxon 9606
Protein NP_570128.2
protein S100-Z
Homo sapiens
Gene S100Z, UniProt Q8WXG8
>NP_570128.2|Haemophilus ducreyi 35000HP|protein S100-Z
MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQKETQLVDKIVQDLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.74 | 2.74062842666438 | 2.7e-10 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)