Host taxon 9606
Protein NP_002956.1
protein S100-A9
Homo sapiens
Gene S100A9, UniProt P06702
>NP_002956.1|Haemophilus ducreyi 35000HP|protein S100-A9
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.46 | 6.45930472805264 | 2.9e-15 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)