Host taxon 9606
Protein NP_002954.2
protein S100-A7
Homo sapiens
Gene S100A7, UniProt P31151
>NP_002954.2|Haemophilus ducreyi 35000HP|protein S100-A7
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.18 | 6.18282675313171 | 1.3e-14 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)