Host taxon 9606
Protein NP_002953.2
protein S100-A5
Homo sapiens
Gene S100A5, UniProt P33763
>NP_002953.2|Haemophilus ducreyi 35000HP|protein S100-A5
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.33 | -1.32805666117872 | 2.5e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)