Host taxon 9606
Protein NP_002951.1
protein S100-A3
Homo sapiens
Gene S100A3, UniProt P33764
>NP_002951.1|Haemophilus ducreyi 35000HP|protein S100-A3
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.06 | 1.05940167138576 | 0.05 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)