Host taxon 9606
Protein NP_001303936.1
protein S100-A16
Homo sapiens
Gene S100A16, UniProt Q96FQ6
>NP_001303936.1|Haemophilus ducreyi 35000HP|protein S100-A16
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.96 | 0.958947771246823 | 0.0037 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)