Host taxon 9606
Protein NP_005611.1
protein S100-A11
Homo sapiens
Gene S100A11, UniProt P31949
>NP_005611.1|Haemophilus ducreyi 35000HP|protein S100-A11
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.66 | 2.6565084438069 | 9.7e-14 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)