Host taxon 9606
Protein NP_001229393.1
protein phosphatase 1 regulatory subunit 1B isoform 2
Homo sapiens
Gene PPP1R1B, UniProt Q9UD71
>NP_001229393.1|Haemophilus ducreyi 35000HP|protein phosphatase 1 regulatory subunit 1B isoform 2
MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.55 | -1.54877574543561 | 0.0052 | 31213562 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)