Host taxon 9606
Protein NP_619634.1
protein phosphatase 1 regulatory subunit 14B
Homo sapiens
Gene PPP1R14B, UniProt Q96C90
>NP_619634.1|Haemophilus ducreyi 35000HP|protein phosphatase 1 regulatory subunit 14B
MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.9 | 0.901292817721096 | 0.00018 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)