Host taxon 9606
Protein NP_001164626.1
protein PET100 homolog, mitochondrial
Homo sapiens
Gene PET100, UniProt P0DJ07
>NP_001164626.1|Haemophilus ducreyi 35000HP|protein PET100 homolog, mitochondrial
MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQQNS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.59 | 1.59200796059479 | 2.2e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)