Host taxon 9606
Protein NP_001302423.1
protein myomixer precursor
Homo sapiens
Gene MYMX, UniProt A0A1B0GTQ4
>NP_001302423.1|Haemophilus ducreyi 35000HP|protein myomixer precursor
MPTPLLPLLLRLLLSCLLLPAARLARQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.25 | -1.24986519833555 | 0.0074 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)