Host taxon 9606
Protein NP_002428.1
protein Mpv17
Homo sapiens
Gene MPV17, UniProt P39210
>NP_002428.1|Haemophilus ducreyi 35000HP|protein Mpv17
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.65 | 0.645401006434383 | 0.0061 | 31213562 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)