Host taxon 9606
Protein NP_054796.1
protein FAM32A
Homo sapiens
Gene FAM32A, UniProt Q9Y421
>NP_054796.1|Haemophilus ducreyi 35000HP|protein FAM32A
MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.07 | 1.07382218822489 | 6.4e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)