Host taxon 9606
Protein NP_001308849.1
protein FAM219B isoform a
Homo sapiens
Gene FAM219B, UniProt Q5XKK7
>NP_001308849.1|Haemophilus ducreyi 35000HP|protein FAM219B isoform a
MATAEPSGRALRLSTPGPRPSGARDRAPGAAGPPSGQIGNRALRLGERTPAAVEKRGPYMVTRAPSIQAKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSDSDGELGSRYSSGYSSAEQVNQDVSRQLLQDGYHLDEIPDDEDLDLIPPKPMASSTCSCCWCCLGDSSSCTLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.56 | -0.562183097260368 | 0.0024 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)