Host taxon 9606
Protein NP_001094846.2
protein FAM183A
Homo sapiens
Gene FAM183A, UniProt A6NL82
>NP_001094846.2|Haemophilus ducreyi 35000HP|protein FAM183A
MAGHPKEKVIPDEVHQNQILRELYLKELRTQKLYTQYHVNPLRKIHTVTRKPMSWHDNLEEPADARFLNLIHHAAQGPRKKYPETQTENQEVGWDLEPLINPERHDRRLNHFRVCSDITLYKAKTWGLGDDHHK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.43 | -1.4279297080566 | 0.0011 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)