Host taxon 9606
Protein NP_001269624.1
protein FAM107B isoform a
Homo sapiens
Gene FAM107B, UniProt Q9H098
>NP_001269624.1|Haemophilus ducreyi 35000HP|protein FAM107B isoform a
MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.89 | 0.891617516669291 | 1.5e-5 | 31213562 | |
Retrieved 1 of 1 entries in 9.9 ms
(Link to these results)