Host taxon 9606
Protein NP_001165378.1
protein CXorf40A isoform a
Homo sapiens
Gene EOLA1, UniProt Q8TE69
>NP_001165378.1|Haemophilus ducreyi 35000HP|protein CXorf40A isoform a
MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.45 | 0.451540909472038 | 0.035 | 31213562 | |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)