Host taxon 9606
Protein NP_872359.1
protein cornichon homolog 2
Homo sapiens
Gene CNIH2, UniProt Q6PI25
>NP_872359.1|Haemophilus ducreyi 35000HP|protein cornichon homolog 2
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.54 | -0.543845606287039 | 0.018 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)