Host taxon 9606
Protein NP_001177920.1
protein canopy homolog 2 isoform 2 precursor
Homo sapiens
Gene CNPY2, UniProt Q9Y2B0
>NP_001177920.1|Haemophilus ducreyi 35000HP|protein canopy homolog 2 isoform 2 precursor
MKGWGWLALLLGALLGTAWARRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVTVTVPPNKVAHSGFG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.7 | 0.704188405815845 | 0.0018 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)