Host taxon 9606
Protein NP_006754.1
protein BTG2
Homo sapiens
Gene BTG2, UniProt P78543
>NP_006754.1|Haemophilus ducreyi 35000HP|protein BTG2
MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.36 | 1.36453474788311 | 0.0001 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)