Host taxon 9606
Protein NP_060932.2
protein BRICK1
Homo sapiens
Gene BRK1, UniProt Q8WUW1
>NP_060932.2|Haemophilus ducreyi 35000HP|protein BRICK1
MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.92 | 0.921151120739862 | 1.6e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)