Host taxon 9606
Protein NP_001073894.1
protein BEX4
Homo sapiens
Gene BEX4, UniProt Q9NWD9
>NP_001073894.1|Haemophilus ducreyi 35000HP|protein BEX4
MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.57 | 0.572098091213461 | 0.014 | 31213562 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)