Host taxon 9606
Protein NP_001129578.1
protein BEAN1 isoform 2
Homo sapiens
Gene BEAN1, UniProt Q3B7T3
>NP_001129578.1|Haemophilus ducreyi 35000HP|protein BEAN1 isoform 2
MRYACSSSEDWPPPLDISSDGDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPDPGPRGSQGSPTPTRAPASGPERIV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.92 | -0.923725390016198 | 0.0042 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)