Host taxon 9606
Protein NP_001295065.1
protein archease isoform 3
Homo sapiens
Gene ZBTB8OS, UniProt Q8IWT0
>NP_001295065.1|Haemophilus ducreyi 35000HP|protein archease isoform 3
MKGGSRVSNPAVMAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPRVGRRIFIVQAPSGNRSQSNNIFSNAGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.34 | 0.344335533678609 | 0.0033 | 31213562 | |
Retrieved 1 of 3 entries in 1.4 ms
(Link to these results)