Host taxon 9606
Protein NP_001124197.1
proteasome subunit beta type-5 isoform 2
Homo sapiens
Gene PSMB5, UniProt P28074
>NP_001124197.1|Haemophilus ducreyi 35000HP|proteasome subunit beta type-5 isoform 2
MAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.86 | 0.864970038622956 | 0.0011 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)