Host taxon 9606
Protein NP_002785.1
proteasome subunit beta type-2 isoform 1
Homo sapiens
Gene PSMB2, UniProt P49721
>NP_002785.1|Haemophilus ducreyi 35000HP|proteasome subunit beta type-2 isoform 1
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.77 | 0.77121455161999 | 8.7e-6 | 31213562 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)