Host taxon 9606
Protein NP_001310336.1
proteasome inhibitor PI31 subunit isoform 3
Homo sapiens
Gene PSMF1, UniProt Q92530
>NP_001310336.1|Haemophilus ducreyi 35000HP|proteasome inhibitor PI31 subunit isoform 3
MILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPRPDRRGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.43 | 0.427959280757745 | 0.042 | 31213562 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)