Host taxon 9606
Protein NP_001122063.1
proteasome assembly chaperone 4 isoform b
Homo sapiens
Gene PSMG4, UniProt Q5JS54
>NP_001122063.1|Haemophilus ducreyi 35000HP|proteasome assembly chaperone 4 isoform b
MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.4 | -0.401462322662347 | 0.021 | 31213562 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)