Host taxon 9606
Protein NP_001127812.1
proteasome assembly chaperone 3
Homo sapiens
Gene PSMG3, UniProt Q9BT73
>NP_001127812.1|Haemophilus ducreyi 35000HP|proteasome assembly chaperone 3
MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.78 | 0.784942053406762 | 0.00046 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)