Host taxon 9606
Protein NP_005663.2
prostate stem cell antigen preproprotein
Homo sapiens
Gene PSCA, UniProt D3DWI6
>NP_005663.2|Haemophilus ducreyi 35000HP|prostate stem cell antigen preproprotein
MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.64 | -1.63814204701976 | 7.5e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)