Host taxon 9606
Protein NP_001014442.2
prostate collagen triple helix protein isoform a
Homo sapiens
Gene PCOTH, UniProt Q58A44
>NP_001014442.2|Haemophilus ducreyi 35000HP|prostate collagen triple helix protein isoform a
MWILSNLMGTSEEGNLLSTVSPTVKALFGKTRVSPIFPFSPRSPFQPLIPRTPGSPWGPVGPASPLGPGFPIGPMGPGKPVGPKGPMLPLGPSGPVGPTSPLFPFCP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.6 | -2.60117271006099 | 8.8e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)