Host taxon 9606
Protein NP_001269530.1
prostaglandin E synthase 3 isoform b
Homo sapiens
Gene PTGES3, UniProt Q15185
>NP_001269530.1|Haemophilus ducreyi 35000HP|prostaglandin E synthase 3 isoform b
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEDSQDSDDEKMPDLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.58 | 0.576623681711276 | 0.00037 | 31213562 | |
Retrieved 1 of 4 entries in 1.8 ms
(Link to these results)