Host taxon 9606
Protein NP_004869.1
prostaglandin E synthase
Homo sapiens
Gene PTGES, UniProt O14684
>NP_004869.1|Haemophilus ducreyi 35000HP|prostaglandin E synthase
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.39 | 1.39073899193151 | 1.5e-10 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)