Host taxon 9606
Protein NP_001157729.1
proline-rich protein 29 isoform 2
Homo sapiens
Gene PRR29, UniProt P0C7W0
>NP_001157729.1|Haemophilus ducreyi 35000HP|proline-rich protein 29 isoform 2
MASGAGGSWGRSPPQSAVPTPWVTFLQPLSWAVPPAPPQPGRVKEDLLELMMLQNAQMHQLLLSRLVAGALQPRPASPCPQVYLEVPQEEPEEEEEEMDVREKGPLVFHHHYLPYLMPSPGALLPWPAPFFPTPACQPYLQDVPRIQHCPASREREVRAVPPPPPPSATGTVGADVPPASDYYDAESLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.22 | 1.21614570263787 | 0.01 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)