Host taxon 9606
Protein NP_001005354.1
proline-rich protein 13 isoform 2
Homo sapiens
Gene PRR13, UniProt Q9NZ81
>NP_001005354.1|Haemophilus ducreyi 35000HP|proline-rich protein 13 isoform 2
MWNPNAGGPPHPVPQPGYPGCQPLGPYPPPYPPPAPGIPPVNPLAPGMVGPAVIVDKKMQKKMKKAHKKMHKHQKHHKYHKHGKHSSSSSSSSSSDSD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.64 | 1.64394016138192 | 1.5e-8 | 31213562 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)