Host taxon 9606
Protein NP_060231.1
proline-rich nuclear receptor coactivator 2
Homo sapiens
Gene PNRC2, UniProt Q9NPJ4
>NP_060231.1|Haemophilus ducreyi 35000HP|proline-rich nuclear receptor coactivator 2
MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.55 | 0.545959976270708 | 0.0023 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)