Host taxon 9606
Protein NP_001119600.1
prokineticin-2 isoform a precursor
Homo sapiens
Gene PROK2, UniProt Q9HC23
>NP_001119600.1|Haemophilus ducreyi 35000HP|prokineticin-2 isoform a precursor
MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6,95 | 6.95098553759424 | 6,9e-15 | 31213562 | |
Retrieved 1 of 1 entries in 0,8 ms
(Link to these results)