Host taxon 9606
Protein NP_115790.1
prokineticin-1 precursor
Homo sapiens
Gene PROK1, UniProt P58294
>NP_115790.1|Haemophilus ducreyi 35000HP|prokineticin-1 precursor
MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.11 | -3.11344923381668 | 5.1e-6 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)