Host taxon 9606
Protein NP_001936.1
proheparin-binding EGF-like growth factor precursor
Homo sapiens
Gene HBEGF, UniProt Q99075
>NP_001936.1|Haemophilus ducreyi 35000HP|proheparin-binding EGF-like growth factor precursor
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.3 | 2.29917324592899 | 0.00044 | 31213562 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)