Host taxon 9606
Protein NP_004699.1
programmed cell death protein 5
Homo sapiens
Gene PDCD5, UniProt O14737
>NP_004699.1|Haemophilus ducreyi 35000HP|programmed cell death protein 5
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.09 | 1.09119172714597 | 1.4e-5 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)