Host taxon 9606
Protein NP_009148.2
programmed cell death protein 10
Homo sapiens
Gene PDCD10, UniProt Q9BUL8
>NP_009148.2|Haemophilus ducreyi 35000HP|programmed cell death protein 10
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.61 | 0.607464300307809 | 0.00033 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)